Lineage for d3hw4b1 (3hw4 B:1-197)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136662Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2136663Protein PA N-terminal domain [254375] (5 species)
  7. 2136686Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries)
  8. 2136692Domain d3hw4b1: 3hw4 B:1-197 [246587]
    Other proteins in same PDB: d3hw4a2, d3hw4b2, d3hw4c2, d3hw4d2
    automated match to d3ebja_
    complexed with mg, tmp

Details for d3hw4b1

PDB Entry: 3hw4 (more details), 1.9 Å

PDB Description: Crystal structure of avian influenza A virus in complex with TMP
PDB Compounds: (B:) Polymerase acidic protein

SCOPe Domain Sequences for d3hw4b1:

Sequence, based on SEQRES records: (download)

>d3hw4b1 c.52.1.34 (B:1-197) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
tiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrglwdsfrqserg

Sequence, based on observed residues (ATOM records): (download)

>d3hw4b1 c.52.1.34 (B:1-197) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfhrfeiie
grdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankiks
ekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserg

SCOPe Domain Coordinates for d3hw4b1:

Click to download the PDB-style file with coordinates for d3hw4b1.
(The format of our PDB-style files is described here.)

Timeline for d3hw4b1: