SCOPe 2.06: Domain d3hn4a3: 3hn4 A:211-289

Lineage for d3hn4a3 (3hn4 A:211-289)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)

8. Domain d3hn4a3: 3hn4 A:211-289 [246521]
   Other proteins in same PDB: d3hn4a1
   automated match to d1bhta2
   complexed with epe, mpd, so4

Details for d3hn4a3

PDB Entry: 3hn4, 2.6 Å

PDB Description: crystal structure of the nk2 fragment (28-289) of human hepatocyte growth factor/scatter factor

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3hn4a3:

Sequence; same for both SEQRES and ATOM records:

>d3hn4a3 g.14.1.1 (A:211-289) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
cmtangesyrglmdhtesgkicqrwdhqtphrhkflperypdkgfddnycrnpdgqprpw
cytldphtrweycaiktca

Timeline for d3hn4a3:

• d3hn4a3 first appeared in SCOPe 2.04
  
• d3hn4a3 appears in SCOPe 2.05
  
• d3hn4a3 appears in SCOPe 2.07
  
• d3hn4a3 appears in the current release, SCOPe 2.08