SCOPe 2.06: Domain d3hn4a1: 3hn4 A:34-126

Lineage for d3hn4a1 (3hn4 A:34-126)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d3hn4a1: 3hn4 A:34-126 [246519]
   Other proteins in same PDB: d3hn4a2, d3hn4a3
   automated match to d1bhta1
   complexed with epe, mpd, so4

Details for d3hn4a1

PDB Entry: 3hn4, 2.6 Å

PDB Description: crystal structure of the nk2 fragment (28-289) of human hepatocyte growth factor/scatter factor

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3hn4a1:

Sequence; same for both SEQRES and ATOM records:

>d3hn4a1 g.10.1.1 (A:34-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
krrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkar
kqclwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d3hn4a1:

• d3hn4a1 first appeared in SCOPe 2.04
  
• d3hn4a1 appears in SCOPe 2.05
  
• d3hn4a1 appears in SCOPe 2.07
  
• d3hn4a1 appears in the current release, SCOPe 2.08