Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Bartonella henselae [TaxId:38323] [255863] (1 PDB entry) |
Domain d3hm0c_: 3hm0 C: [246508] automated match to d4k00a_ |
PDB Entry: 3hm0 (more details), 2.5 Å
SCOPe Domain Sequences for d3hm0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hm0c_ d.38.1.0 (C:) automated matches {Bartonella henselae [TaxId: 38323]} afhdfqarvyvadtdfsgvvyharyleffergrseflrdtgfnntllasgvegeklffvv rhmeinfsrpaqidnlltiktrisrlqgarffmeqyilhgesmlvtakveialineegkp rrlp
Timeline for d3hm0c_: