Lineage for d3hm0d_ (3hm0 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944355Species Bartonella henselae [TaxId:38323] [255863] (1 PDB entry)
  8. 2944359Domain d3hm0d_: 3hm0 D: [246509]
    automated match to d4k00a_

Details for d3hm0d_

PDB Entry: 3hm0 (more details), 2.5 Å

PDB Description: crystal structure of probable thioesterase from bartonella henselae
PDB Compounds: (D:) probable thioesterase

SCOPe Domain Sequences for d3hm0d_:

Sequence, based on SEQRES records: (download)

>d3hm0d_ d.38.1.0 (D:) automated matches {Bartonella henselae [TaxId: 38323]}
nafhdfqarvyvadtdfsgvvyharyleffergrseflrdtgfnntllasgvegeklffv
vrhmeinfsrpaqidnlltiktrisrlqgarffmeqyilhgesmlvtakveialineegk
prrlp

Sequence, based on observed residues (ATOM records): (download)

>d3hm0d_ d.38.1.0 (D:) automated matches {Bartonella henselae [TaxId: 38323]}
nafhdfqarvyvadtdfsgvvyharyleffergrseflrdtgfeklffvvrhmeinfsrp
aqidnlltiktrisrlqgarffmeqyilhgesmlvtakveialineegkprrlp

SCOPe Domain Coordinates for d3hm0d_:

Click to download the PDB-style file with coordinates for d3hm0d_.
(The format of our PDB-style files is described here.)

Timeline for d3hm0d_: