| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
| Family d.6.1.1: Prion-like [54099] (3 proteins) |
| Protein automated matches [191016] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries) |
| Domain d3hafa_: 3haf A: [246488] automated match to d1fo7a_ complexed with cd, cl |
PDB Entry: 3haf (more details), 2.26 Å
SCOPe Domain Sequences for d3hafa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hafa_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvgglggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdc
vnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqay
Timeline for d3hafa_: