SCOPe 2.04: Domain d3hafa_: 3haf A:

Lineage for d3hafa_ (3haf A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)

8. Domain d3hafa_: 3haf A: [246488]
   automated match to d1fo7a_
   complexed with cd, cl

Details for d3hafa_

PDB Entry: 3haf, 2.26 Å

PDB Description: human prion protein variant v129 domain swapped dimer

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3hafa_:

Sequence; same for both SEQRES and ATOM records:

>d3hafa_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvgglggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdc
vnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqay

Timeline for d3hafa_:

• d3hafa_ is new in SCOPe 2.04-stable
  
• d3hafa_ appears in SCOPe 2.05
  
• d3hafa_ appears in the current release, SCOPe 2.08