SCOPe 2.08: Domain d3h1hf_: 3h1h F:

Lineage for d3h1hf_ (3h1h F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)

8. Domain d3h1hf_: 3h1h F: [246422]
   Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1ht_, d3h1hu_, d3h1hw_
   automated match to d1l0lf_
   complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hf_

PDB Entry: 3h1h, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d3h1hf_:

Sequence; same for both SEQRES and ATOM records:

>d3h1hf_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

Timeline for d3h1hf_:

• d3h1hf_ first appeared in SCOPe 2.04
  
• d3h1hf_ appears in SCOPe 2.07