Lineage for d3h1hq1 (3h1h Q:1-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691442Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2691486Protein automated matches [232767] (3 species)
    not a true protein
  7. 2691491Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)
  8. 2691505Domain d3h1hq1: 3h1h Q:1-195 [246432]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l71d1
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hq1

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (Q:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3h1hq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hq1 a.3.1.3 (Q:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

SCOPe Domain Coordinates for d3h1hq1:

Click to download the PDB-style file with coordinates for d3h1hq1.
(The format of our PDB-style files is described here.)

Timeline for d3h1hq1: