SCOPe 2.07: Domain d3gwkc1: 3gwk C:4-97

Lineage for d3gwkc1 (3gwk C:4-97)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries)

8. Domain d3gwkc1: 3gwk C:4-97 [246376]
   Other proteins in same PDB: d3gwkc2, d3gwke2
   automated match to d3gvmc_
   complexed with so4

Details for d3gwkc1

PDB Entry: 3gwk, 1.3 Å

PDB Description: Structure of the homodimeric WXG-100 family protein from Streptococcus agalactiae

PDB Compounds: (C:) Putative uncharacterized protein SAG1039

SCOPe Domain Sequences for d3gwkc1:

Sequence; same for both SEQRES and ATOM records:

>d3gwkc1 a.25.3.0 (C:4-97) automated matches {Streptococcus agalactiae [TaxId: 208435]}
qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki
tefaqlledinqqllkvadiieqtdadiasqisg

Timeline for d3gwkc1:

• d3gwkc1 first appeared in SCOPe 2.04, called d3gwkc_
  
• d3gwkc1 appears in SCOPe 2.06
  
• d3gwkc1 appears in the current release, SCOPe 2.08