Lineage for d3gvmc_ (3gvm C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1730421Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 1730435Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 1730436Protein automated matches [193225] (4 species)
    not a true protein
  7. 1730471Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries)
  8. 1730476Domain d3gvmc_: 3gvm C: [232339]
    automated match to d4j7kb_

Details for d3gvmc_

PDB Entry: 3gvm (more details), 2.15 Å

PDB Description: structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
PDB Compounds: (C:) Putative uncharacterized protein SAG1039

SCOPe Domain Sequences for d3gvmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvmc_ a.25.3.0 (C:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
gamsqikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnel
spkitefaqlledinqqllkvadiieqtdadiasqis

SCOPe Domain Coordinates for d3gvmc_:

Click to download the PDB-style file with coordinates for d3gvmc_.
(The format of our PDB-style files is described here.)

Timeline for d3gvmc_: