Lineage for d1c0ma1 (1c0m A:217-269)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461736Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (1 family) (S)
  5. 461737Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 461738Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 461748Species Rous sarcoma virus (RSV, avian sarcoma virus) [50126] (2 PDB entries)
  8. 461749Domain d1c0ma1: 1c0m A:217-269 [24635]
    Other proteins in same PDB: d1c0ma2, d1c0mb2, d1c0mc2, d1c0md2

Details for d1c0ma1

PDB Entry: 1c0m (more details), 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase

SCOP Domain Sequences for d1c0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ma1 b.34.7.1 (A:217-269) DNA-binding domain of retroviral integrase {Rous sarcoma virus (RSV, avian sarcoma virus)}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi

SCOP Domain Coordinates for d1c0ma1:

Click to download the PDB-style file with coordinates for d1c0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1c0ma1: