Lineage for d3gpua1 (3gpu A:2-134)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430477Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2430478Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2430479Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2430480Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2430481Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)
  8. 2430489Domain d3gpua1: 3gpu A:2-134 [246338]
    Other proteins in same PDB: d3gpua2, d3gpua3
    automated match to d1l1za2
    protein/DNA complex; complexed with zn

Details for d3gpua1

PDB Entry: 3gpu (more details), 1.62 Å

PDB Description: mutm encountering an intrahelical 8-oxoguanine (oxog) lesion in ec4- loop deletion complex
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3gpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpua1 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOPe Domain Coordinates for d3gpua1:

Click to download the PDB-style file with coordinates for d3gpua1.
(The format of our PDB-style files is described here.)

Timeline for d3gpua1: