SCOPe 2.06: Domain d3gpua1: 3gpu A:2-134

Lineage for d3gpua1 (3gpu A:2-134)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)

8. Domain d3gpua1: 3gpu A:2-134 [246338]
   Other proteins in same PDB: d3gpua2, d3gpua3
   automated match to d1l1za2
   protein/DNA complex; complexed with zn

Details for d3gpua1

PDB Entry: 3gpu, 1.62 Å

PDB Description: mutm encountering an intrahelical 8-oxoguanine (oxog) lesion in ec4- loop deletion complex

PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3gpua1:

Sequence; same for both SEQRES and ATOM records:

>d3gpua1 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

Timeline for d3gpua1:

• d3gpua1 first appeared in SCOPe 2.04
  
• d3gpua1 appears in SCOPe 2.05
  
• d3gpua1 appears in SCOPe 2.07
  
• d3gpua1 appears in the current release, SCOPe 2.08