Lineage for d3gipa3 (3gip A:419-478)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428725Family b.92.1.0: automated matches [254292] (1 protein)
    not a true family
  6. 2428726Protein automated matches [254676] (1 species)
    not a true protein
  7. 2428727Species Bordetella bronchiseptica [TaxId:518] [255847] (2 PDB entries)
  8. 2428729Domain d3gipa3: 3gip A:419-478 [246306]
    Other proteins in same PDB: d3gipa2, d3gipb2
    automated match to d1rk6a2
    complexed with acy, fmt, zn

Details for d3gipa3

PDB Entry: 3gip (more details), 1.5 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc, acetate and formate ions.
PDB Compounds: (A:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3gipa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gipa3 b.92.1.0 (A:419-478) automated matches {Bordetella bronchiseptica [TaxId: 518]}
vlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlra

SCOPe Domain Coordinates for d3gipa3:

Click to download the PDB-style file with coordinates for d3gipa3.
(The format of our PDB-style files is described here.)

Timeline for d3gipa3: