Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (34 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [255848] (2 PDB entries) |
Domain d3gipa2: 3gip A:61-418 [246305] Other proteins in same PDB: d3gipa1, d3gipa3, d3gipb1, d3gipb3 automated match to d1rk6a3 complexed with acy, fmt, zn |
PDB Entry: 3gip (more details), 1.5 Å
SCOPe Domain Sequences for d3gipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gipa2 c.1.9.0 (A:61-418) automated matches {Bordetella bronchiseptica [TaxId: 518]} gfidvhghddlmfvekpdlrwktsqgittvvvgncgvsaapaplpgntaaalallgetpl fadvpayfaaldaqrpminvaalvghanlrlaamrdpqaaptaaeqqamqdmlqaaleag avgfstglayqpgavaqaaeleglarvaaerrrlhtshirneadgveaaveevlaigrgt gcatvvshhkcmmpqnwgrsratlanidrareqgvevaldiypypgsstiliperaetid diritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdedevkrifqhpcc mvgsdglpndarphprlwgsftrvlgryvrearlmtleqavarmtalparvfgfaerg
Timeline for d3gipa2: