SCOPe 2.08: Domain d3g7ca1: 3g7c A:416-522

Lineage for d3g7ca1 (3g7c A:416-522)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.17: occludin/ELL-like [144292] (2 families)
   antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)

5. Family h.4.17.1: Occludin/ELL domain [144293] (1 protein)
   Pfam PF07303

6. Protein Occludin [144294] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries)
   Uniprot Q16625 416-522

8. Domain d3g7ca1: 3g7c A:416-522 [246256]
   Other proteins in same PDB: d3g7ca2
   automated match to d1wpaa1

Details for d3g7ca1

PDB Entry: 3g7c, 2 Å

PDB Description: structure of the phosphorylation mimetic of occludin c-term tail

PDB Compounds: (A:) Occludin

SCOPe Domain Sequences for d3g7ca1:

Sequence; same for both SEQRES and ATOM records:

>d3g7ca1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]}
wireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreeseeym
aaadeynrlkqvkgdadykskknhckqlksklshikkmvgdydrqkt

Timeline for d3g7ca1:

• d3g7ca1 first appeared in SCOPe 2.04, called d3g7ca_
  
• d3g7ca1 appears in SCOPe 2.07