Lineage for d3g7ca1 (3g7c A:416-522)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2592663Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2592799Superfamily h.4.17: occludin/ELL-like [144292] (2 families) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 2592800Family h.4.17.1: Occludin/ELL domain [144293] (1 protein)
    Pfam PF07303
  6. 2592801Protein Occludin [144294] (1 species)
  7. 2592802Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries)
    Uniprot Q16625 416-522
  8. 2592805Domain d3g7ca1: 3g7c A:416-522 [246256]
    Other proteins in same PDB: d3g7ca2
    automated match to d1wpaa1

Details for d3g7ca1

PDB Entry: 3g7c (more details), 2 Å

PDB Description: Structure of the Phosphorylation Mimetic of Occludin C-term Tail
PDB Compounds: (A:) Occludin

SCOPe Domain Sequences for d3g7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7ca1 h.4.17.1 (A:416-522) Occludin {Human (Homo sapiens) [TaxId: 9606]}
wireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreeseeym
aaadeynrlkqvkgdadykskknhckqlksklshikkmvgdydrqkt

SCOPe Domain Coordinates for d3g7ca1:

Click to download the PDB-style file with coordinates for d3g7ca1.
(The format of our PDB-style files is described here.)

Timeline for d3g7ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g7ca2