Lineage for d3g7ca_ (3g7c A:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1710138Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 1710264Superfamily h.4.17: occludin/ELL-like [144292] (1 family) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 1710265Family h.4.17.1: Occludin/ELL domain [144293] (1 protein)
    Pfam PF07303
  6. 1710266Protein Occludin [144294] (1 species)
  7. 1710267Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries)
    Uniprot Q16625 416-522
  8. 1710270Domain d3g7ca_: 3g7c A: [246256]
    automated match to d1wpaa1

Details for d3g7ca_

PDB Entry: 3g7c (more details), 2 Å

PDB Description: structure of the phosphorylation mimetic of occludin c-term tail
PDB Compounds: (A:) Occludin

SCOPe Domain Sequences for d3g7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7ca_ h.4.17.1 (A:) Occludin {Human (Homo sapiens) [TaxId: 9606]}
eewireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreesee
ymaaadeynrlkqvkgdadykskknhckqlksklshikkmvgdydrqkt

SCOPe Domain Coordinates for d3g7ca_:

Click to download the PDB-style file with coordinates for d3g7ca_.
(The format of our PDB-style files is described here.)

Timeline for d3g7ca_: