![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
![]() | Superfamily h.4.17: occludin/ELL-like [144292] (1 family) ![]() antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731) |
![]() | Family h.4.17.1: Occludin/ELL domain [144293] (1 protein) Pfam PF07303 |
![]() | Protein Occludin [144294] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144295] (3 PDB entries) Uniprot Q16625 416-522 |
![]() | Domain d3g7ca_: 3g7c A: [246256] automated match to d1wpaa1 |
PDB Entry: 3g7c (more details), 2 Å
SCOPe Domain Sequences for d3g7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7ca_ h.4.17.1 (A:) Occludin {Human (Homo sapiens) [TaxId: 9606]} eewireyppitsdqqrqlykrnfdtglqeykslqseldeinkelsrldkelddyreesee ymaaadeynrlkqvkgdadykskknhckqlksklshikkmvgdydrqkt
Timeline for d3g7ca_: