Lineage for d3g76f1 (3g76 F:255-356)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038285Domain d3g76f1: 3g76 F:255-356 [246251]
    Other proteins in same PDB: d3g76b2, d3g76d2, d3g76f2, d3g76h2
    automated match to d1tfqa_
    complexed with cz3, zn

Details for d3g76f1

PDB Entry: 3g76 (more details), 3 Å

PDB Description: Crystal structure of XIAP-BIR3 in complex with a bivalent compound
PDB Compounds: (F:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3g76f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g76f1 g.52.1.1 (F:255-356) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpse
dpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d3g76f1:

Click to download the PDB-style file with coordinates for d3g76f1.
(The format of our PDB-style files is described here.)

Timeline for d3g76f1: