SCOPe 2.08: Domain d3g76d1: 3g76 D:253-356

Lineage for d3g76d1 (3g76 D:253-356)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d3g76d1: 3g76 D:253-356 [246249]
   Other proteins in same PDB: d3g76b2, d3g76d2, d3g76f2, d3g76h2
   automated match to d1tfqa_
   complexed with cz3, zn

Details for d3g76d1

PDB Entry: 3g76, 3 Å

PDB Description: Crystal structure of XIAP-BIR3 in complex with a bivalent compound

PDB Compounds: (D:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3g76d1:

Sequence; same for both SEQRES and ATOM records:

>d3g76d1 g.52.1.1 (D:253-356) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
sedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

Timeline for d3g76d1:

• d3g76d1 first appeared in SCOPe 2.04, called d3g76d_
  
• d3g76d1 appears in SCOPe 2.07