Lineage for d3fg6e3 (3fg6 E:613-715)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210377Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2210378Protein automated matches [190971] (12 species)
    not a true protein
  7. 2210394Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries)
  8. 2210410Domain d3fg6e3: 3fg6 E:613-715 [246144]
    automated match to d1npha3
    complexed with ca

Details for d3fg6e3

PDB Entry: 3fg6 (more details), 3 Å

PDB Description: structure of the c-terminus of adseverin
PDB Compounds: (E:) Adseverin

SCOPe Domain Sequences for d3fg6e3:

Sequence, based on SEQRES records: (download)

>d3fg6e3 d.109.1.0 (E:613-715) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pprlygcsnktgrfvieeipgeftqddlaeddvmlldaweqifiwigkdanevekkeslk
sakmyletdpsgrdkrtpiviikqghepptftgwflgwdsskw

Sequence, based on observed residues (ATOM records): (download)

>d3fg6e3 d.109.1.0 (E:613-715) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pprlygcsnktgrfvieeipgeftqddlaeddvmlldaweqifiwigkdanevekkeslk
sakmyltpiviikqghepptftgwflgwdsskw

SCOPe Domain Coordinates for d3fg6e3:

Click to download the PDB-style file with coordinates for d3fg6e3.
(The format of our PDB-style files is described here.)

Timeline for d3fg6e3: