Lineage for d3ffke2 (3ffk E:147-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2884130Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)
  8. 2884155Domain d3ffke2: 3ffk E:147-370 [246116]
    Other proteins in same PDB: d3ffka1, d3ffka2, d3ffka3, d3ffkb1, d3ffkd1, d3ffkd2, d3ffkd3, d3ffke1
    automated match to d1c0fa2
    complexed with atp, ca

Details for d3ffke2

PDB Entry: 3ffk (more details), 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin
PDB Compounds: (E:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3ffke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffke2 c.55.1.1 (E:147-370) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsiv

SCOPe Domain Coordinates for d3ffke2:

Click to download the PDB-style file with coordinates for d3ffke2.
(The format of our PDB-style files is described here.)

Timeline for d3ffke2: