Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries) |
Domain d3ffkb2: 3ffk B:147-368 [246111] Other proteins in same PDB: d3ffka1, d3ffka2, d3ffka3, d3ffkb1, d3ffkd1, d3ffkd2, d3ffkd3, d3ffke1 automated match to d1c0fa2 complexed with atp, ca |
PDB Entry: 3ffk (more details), 3 Å
SCOPe Domain Sequences for d3ffkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ffkb2 c.55.1.1 (B:147-368) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeydeagps
Timeline for d3ffkb2: