Lineage for d3ffka3 (3ffk A:263-374)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969800Domain d3ffka3: 3ffk A:263-374 [246109]
    Other proteins in same PDB: d3ffkb1, d3ffkb2, d3ffke1, d3ffke2
    automated match to d1d0na3
    complexed with atp, ca

Details for d3ffka3

PDB Entry: 3ffk (more details), 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin
PDB Compounds: (A:) plasma gelsolin

SCOPe Domain Sequences for d3ffka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffka3 d.109.1.1 (A:263-374) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
edaanrklaklykvsngagtmsvslvadenpfaqgalksedcfildhgkdgkifvwkgkq
anteerkaalktasdfitkmdypkqtqvsvlpeggetplfkqffknwrdpdq

SCOPe Domain Coordinates for d3ffka3:

Click to download the PDB-style file with coordinates for d3ffka3.
(The format of our PDB-style files is described here.)

Timeline for d3ffka3: