Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) |
Domain d3f7ga_: 3f7g A: [246033] automated match to d1oxnb_ complexed with 389, p33, zn |
PDB Entry: 3f7g (more details), 2.3 Å
SCOPe Domain Sequences for d3f7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7ga_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet
Timeline for d3f7ga_:
View in 3D Domains from other chains: (mouse over for more information) d3f7gb_, d3f7gc_, d3f7gd_, d3f7ge_ |