PDB entry 3f7g

View 3f7g on RCSB PDB site
Description: Structure of the BIR domain from ML-IAP bound to a peptidomimetic
Class: apoptosis
Keywords: ZINC BINDING, PEPTIDE COMPLEX, APOPTOSIS INHIBITION, PEPTIDOMIMETIC, SMALL MOLECULE, DRUG DESIGN, Apoptosis, Metal-binding, Nucleus, Zinc-finger
Deposited on 2008-11-09, released 2009-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: also known as KIAP OR MLIAP OR LIVIN, BIRC7, KIAP, LIVIN, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f7ga_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: also known as KIAP OR MLIAP OR LIVIN, BIRC7, KIAP, LIVIN, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f7gb_
  • Chain 'C':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: also known as KIAP OR MLIAP OR LIVIN, BIRC7, KIAP, LIVIN, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f7gc_
  • Chain 'D':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: also known as KIAP OR MLIAP OR LIVIN, BIRC7, KIAP, LIVIN, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f7gd_
  • Chain 'E':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: also known as KIAP OR MLIAP OR LIVIN, BIRC7, KIAP, LIVIN, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f7ge_
  • Heterogens: ZN, P33, 389, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f7gA (A:)
    mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpscqfllrskg
    rdfvhsvqethsqllgswdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7gA (A:)
    agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
    lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f7gB (B:)
    mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpscqfllrskg
    rdfvhsvqethsqllgswdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7gB (B:)
    agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
    lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f7gC (C:)
    mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpscqfllrskg
    rdfvhsvqethsqllgswdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7gC (C:)
    agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
    lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeths
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f7gD (D:)
    mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpscqfllrskg
    rdfvhsvqethsqllgswdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7gD (D:)
    agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
    lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqeth
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3f7gE (E:)
    mgsshhhhhhssgevprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpscqfllrskg
    rdfvhsvqethsqllgswdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f7gE (E:)
    gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
    ddpwtehakwfpscqfllrskgrdfvhsvqeths