Lineage for d3exgp1 (3exg P:1-191)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592815Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. 1592853Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)
  7. 1592854Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries)
  8. 1592873Domain d3exgp1: 3exg P:1-191 [245971]
    Other proteins in same PDB: d3exg1_, d3exg22, d3exg3_, d3exg42, d3exg5_, d3exg62, d3exga_, d3exgb2, d3exgc_, d3exgd2, d3exge_, d3exgf2, d3exgg_, d3exgh2, d3exgi_, d3exgj2, d3exgk_, d3exgl2, d3exgm_, d3exgn2, d3exgo_, d3exgp2, d3exgq_, d3exgr2, d3exgs_, d3exgt2, d3exgu_, d3exgv2, d3exgw_, d3exgx2, d3exgy_, d3exgz2
    automated match to d2ozlb1
    complexed with k

Details for d3exgp1

PDB Entry: 3exg (more details), 3.01 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (P:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exgp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exgp1 c.36.1.7 (P:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppeaqskdf

SCOPe Domain Coordinates for d3exgp1:

Click to download the PDB-style file with coordinates for d3exgp1.
(The format of our PDB-style files is described here.)

Timeline for d3exgp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3exgp2
View in 3D
Domains from other chains:
(mouse over for more information)
d3exg1_, d3exg21, d3exg22, d3exg3_, d3exg41, d3exg42, d3exg5_, d3exg61, d3exg62, d3exga_, d3exgb1, d3exgb2, d3exgc_, d3exgd1, d3exgd2, d3exge_, d3exgf1, d3exgf2, d3exgg_, d3exgh1, d3exgh2, d3exgi_, d3exgj1, d3exgj2, d3exgk_, d3exgl1, d3exgl2, d3exgm_, d3exgn1, d3exgn2, d3exgo_, d3exgq_, d3exgr1, d3exgr2, d3exgs_, d3exgt1, d3exgt2, d3exgu_, d3exgv1, d3exgv2, d3exgw_, d3exgx1, d3exgx2, d3exgy_, d3exgz1, d3exgz2