Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (12 species) not a true protein |
Species Avian infectious bronchitis virus [TaxId:11120] [232123] (2 PDB entries) |
Domain d3ewpa1: 3ewp A:1-174 [245925] Other proteins in same PDB: d3ewpa2 automated match to d3ewoa_ protein/RNA complex; complexed with apr |
PDB Entry: 3ewp (more details), 2 Å
SCOPe Domain Sequences for d3ewpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ewpa1 c.50.1.0 (A:1-174) automated matches {Avian infectious bronchitis virus [TaxId: 11120]} vkpatcekpkfleyktcvgdlavviakaldefkefcivnaanehmshgggvakaiadfcg pdfveycadyvkkhgpqqklvtpsfvkgiqcvnnvvgprhgdsnlreklvaayksvlvgg vvnyvvpvlssgifgvdfkisidamreafkgcairvllfslsqehidyfdatck
Timeline for d3ewpa1: