SCOPe 2.02: Domain d1viea_: 1vie A:

Lineage for d1viea_ (1vie A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)

6. Protein R67 dihydrofolate reductase [50092] (1 species)

7. Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries)

8. Domain d1viea_: 1vie A: [24592]

Details for d1viea_

PDB Entry: 1vie, 1.7 Å

PDB Description: structure of dihydrofolate reductase

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1viea_:

Sequence; same for both SEQRES and ATOM records:

>d1viea_ b.34.4.1 (A:) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1 [TaxId: 562]}
psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

Timeline for d1viea_:

• d1viea_ first appeared (with stable ids) in SCOP 1.55, called d1vie__
  
• d1viea_ appears in SCOPe 2.01
  
• d1viea_ appears in SCOPe 2.03
  
• d1viea_ appears in the current release, SCOPe 2.08