Lineage for d1vie__ (1vie -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13246Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 13247Family b.34.4.1: R67 dihydrofolate reductase [50091] (1 protein)
  6. 13248Protein R67 dihydrofolate reductase [50092] (1 species)
  7. 13249Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries)
  8. 13250Domain d1vie__: 1vie - [24592]

Details for d1vie__

PDB Entry: 1vie (more details), 1.7 Å

PDB Description: structure of dihydrofolate reductase

SCOP Domain Sequences for d1vie__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vie__ b.34.4.1 (-) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1}
psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOP Domain Coordinates for d1vie__:

Click to download the PDB-style file with coordinates for d1vie__.
(The format of our PDB-style files is described here.)

Timeline for d1vie__: