Class b: All beta proteins [48724] (177 folds) |
Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
Superfamily b.108.1: Phage fibre proteins [69349] (6 families) |
Family b.108.1.0: automated matches [231970] (1 protein) not a true family |
Protein automated matches [231971] (3 species) not a true protein |
Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries) |
Domain d3ejca1: 3ejc A:2-62 [245874] Other proteins in same PDB: d3ejca2, d3ejca3 automated match to d2f0ca2 |
PDB Entry: 3ejc (more details), 1.85 Å
SCOPe Domain Sequences for d3ejca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejca1 b.108.1.0 (A:2-62) automated matches {Lactococcus phage [TaxId: 35345]} asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt l
Timeline for d3ejca1: