SCOPe 2.04: Domain d3ejca1: 3ejc A:2-62

Lineage for d3ejca1 (3ejc A:2-62)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.0: automated matches [231970] (1 protein)
   not a true family

6. Protein automated matches [231971] (3 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries)

8. Domain d3ejca1: 3ejc A:2-62 [245874]
   Other proteins in same PDB: d3ejca2
   automated match to d2f0ca2

Details for d3ejca1

PDB Entry: 3ejc, 1.85 Å

PDB Description: Full length Receptor Binding Protein from Lactococcal phage TP901-1

PDB Compounds: (A:) Baseplate protein (BPP)

SCOPe Domain Sequences for d3ejca1:

Sequence; same for both SEQRES and ATOM records:

>d3ejca1 b.108.1.0 (A:2-62) automated matches {Lactococcus phage [TaxId: 35345]}
asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
l

Timeline for d3ejca1:

• d3ejca1 is new in SCOPe 2.04-stable
  
• d3ejca1 appears in SCOPe 2.05
  
• d3ejca1 appears in the current release, SCOPe 2.08