Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.0: automated matches [254289] (1 protein) not a true family |
Protein automated matches [254672] (2 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255812] (1 PDB entry) |
Domain d3eb7c1: 3eb7 C:64-291 [245812] Other proteins in same PDB: d3eb7a2, d3eb7a3, d3eb7b2, d3eb7b3, d3eb7c2, d3eb7c3 automated match to d1dlca3 complexed with act, so4 |
PDB Entry: 3eb7 (more details), 2.3 Å
SCOPe Domain Sequences for d3eb7c1:
Sequence, based on SEQRES records: (download)
>d3eb7c1 f.1.3.0 (C:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]} iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr
>d3eb7c1 f.1.3.0 (C:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]} iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin qkiaeyarakalaeleglgnnyqlyltaleewqenpstrvlrdvrnrfeildslftqymp sfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysdh cvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr
Timeline for d3eb7c1: