SCOPe 2.08: Domain d3eb7c1: 3eb7 C:64-291

Lineage for d3eb7c1 (3eb7 C:64-291)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families)
   automatically mapped to Pfam PF03945

5. Family f.1.3.0: automated matches [254289] (1 protein)
   not a true family

6. Protein automated matches [254672] (2 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1428] [255812] (7 PDB entries)

8. Domain d3eb7c1: 3eb7 C:64-291 [245812]
   Other proteins in same PDB: d3eb7a2, d3eb7a3, d3eb7b2, d3eb7b3, d3eb7c2, d3eb7c3
   automated match to d1dlca3
   complexed with act, so4

Details for d3eb7c1

PDB Entry: 3eb7, 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution

PDB Compounds: (C:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7c1:

Sequence, based on SEQRES records:

>d3eb7c1 f.1.3.0 (C:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr

Sequence, based on observed residues (ATOM records):

>d3eb7c1 f.1.3.0 (C:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
qkiaeyarakalaeleglgnnyqlyltaleewqenpstrvlrdvrnrfeildslftqymp
sfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysdh
cvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr

Timeline for d3eb7c1:

• d3eb7c1 first appeared in SCOPe 2.04
  
• d3eb7c1 appears in SCOPe 2.07