Lineage for d3eb7a1 (3eb7 A:64-291)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955230Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 1955254Family f.1.3.0: automated matches [254289] (1 protein)
    not a true family
  6. 1955255Protein automated matches [254672] (2 species)
    not a true protein
  7. 1955256Species Bacillus thuringiensis [TaxId:1428] [255812] (1 PDB entry)
  8. 1955257Domain d3eb7a1: 3eb7 A:64-291 [245806]
    Other proteins in same PDB: d3eb7a2, d3eb7a3, d3eb7b2, d3eb7b3, d3eb7c2, d3eb7c3
    automated match to d1dlca3
    complexed with act, so4

Details for d3eb7a1

PDB Entry: 3eb7 (more details), 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
PDB Compounds: (A:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb7a1 f.1.3.0 (A:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr

SCOPe Domain Coordinates for d3eb7a1:

Click to download the PDB-style file with coordinates for d3eb7a1.
(The format of our PDB-style files is described here.)

Timeline for d3eb7a1: