Lineage for d3e3md1 (3e3m D:69-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144240Species Silicibacter pomeroyi [TaxId:89184] [255808] (1 PDB entry)
  8. 2144244Domain d3e3md1: 3e3m D:69-345 [245796]
    Other proteins in same PDB: d3e3ma2, d3e3mb2, d3e3mc2, d3e3md2
    automated match to d2nzug_

Details for d3e3md1

PDB Entry: 3e3m (more details), 1.6 Å

PDB Description: crystal structure of a laci family transcriptional regulator from silicibacter pomeroyi
PDB Compounds: (D:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d3e3md1:

Sequence, based on SEQRES records: (download)

>d3e3md1 c.93.1.0 (D:69-345) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
gfvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlvetmlrrrpeam
vlsydghteqtirllqrasipiveiwekpahpightvgfsneraaydmtnallargfrki
vflgekdddwtrgaarragfkramreaglnpdqeirlgapplsiedgvaaaelilqeypd
tdcifcvsdmpafgllsrlksigvavpeqvsvvgfgnfevsrfaspeistvrvdpiaigr
etgslilrlldpkqrspqtaqhitlppvlefrpslkn

Sequence, based on observed residues (ATOM records): (download)

>d3e3md1 c.93.1.0 (D:69-345) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
gfvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlvetmlrrrpeam
vlsydghteqtirllqrasipiveiwekpahpightvgfsneraaydmtnallargfrki
vflgekdddwtrgaarragfkramreaglnpdqeirlgapplsiedgvaaaelilqeypd
tdcifcvsdmpafgllsrlksigvavpeqvsvvgfgnfevsrfaspeistvrvdpiaigr
etgslilrlldaqhitlppvlefrpslkn

SCOPe Domain Coordinates for d3e3md1:

Click to download the PDB-style file with coordinates for d3e3md1.
(The format of our PDB-style files is described here.)

Timeline for d3e3md1: