Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:89184] [255808] (2 PDB entries) |
Domain d3e3md1: 3e3m D:69-345 [245796] Other proteins in same PDB: d3e3ma2, d3e3mb2, d3e3mc2, d3e3md2 automated match to d2nzug_ |
PDB Entry: 3e3m (more details), 1.6 Å
SCOPe Domain Sequences for d3e3md1:
Sequence, based on SEQRES records: (download)
>d3e3md1 c.93.1.0 (D:69-345) automated matches {Silicibacter pomeroyi [TaxId: 89184]} gfvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlvetmlrrrpeam vlsydghteqtirllqrasipiveiwekpahpightvgfsneraaydmtnallargfrki vflgekdddwtrgaarragfkramreaglnpdqeirlgapplsiedgvaaaelilqeypd tdcifcvsdmpafgllsrlksigvavpeqvsvvgfgnfevsrfaspeistvrvdpiaigr etgslilrlldpkqrspqtaqhitlppvlefrpslkn
>d3e3md1 c.93.1.0 (D:69-345) automated matches {Silicibacter pomeroyi [TaxId: 89184]} gfvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlvetmlrrrpeam vlsydghteqtirllqrasipiveiwekpahpightvgfsneraaydmtnallargfrki vflgekdddwtrgaarragfkramreaglnpdqeirlgapplsiedgvaaaelilqeypd tdcifcvsdmpafgllsrlksigvavpeqvsvvgfgnfevsrfaspeistvrvdpiaigr etgslilrlldaqhitlppvlefrpslkn
Timeline for d3e3md1: