Class b: All beta proteins [48724] (141 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries) |
Domain d1lvk_1: 1lvk 34-79 [24576] Other proteins in same PDB: d1lvk_2 complexed with bef, mg, mnt; mutant |
PDB Entry: 1lvk (more details), 1.9 Å
SCOP Domain Sequences for d1lvk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvk_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)} yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq
Timeline for d1lvk_1: