Lineage for d1lvka1 (1lvk A:34-79)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783670Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2783671Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2783704Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 2783705Domain d1lvka1: 1lvk A:34-79 [24576]
    Other proteins in same PDB: d1lvka2
    complexed with bef, mg, mnt

Details for d1lvka1

PDB Entry: 1lvk (more details), 1.9 Å

PDB Description: x-ray crystal structure of the mg (dot) 2'(3')-o-(n-methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1lvka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvka1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOPe Domain Coordinates for d1lvka1:

Click to download the PDB-style file with coordinates for d1lvka1.
(The format of our PDB-style files is described here.)

Timeline for d1lvka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lvka2