Lineage for d1lvk_1 (1lvk 34-79)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) 
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) 
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) Protein Myosin S1 fragment, N-terminal domain [50086] (3 species) Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries) 
Domain d1lvk_1: 1lvk 34-79 [24576]
Other proteins in same PDB: d1lvk_2
Details for d1lvk_1
PDB Entry: 1lvk (more details), 1.9 Å
PDB Description: x-ray crystal structure of the mg (dot) 2'(3')-o-(n-methylanthraniloyl) nucleotide bound to dictyostelium discoideum myosin motor domain
SCOP Domain Sequences for d1lvk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvk_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq
SCOP Domain Coordinates for d1lvk_1:
Click to download the PDB-style file with coordinates for d1lvk_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lvk_1:
- d1lvk_1 appears in SCOP 1.57
- d1lvk_1 appears in the current release, SCOPe 2.08, called d1lvka1
View in 3D
