SCOPe 2.04: Domain d3du2m_: 3du2 M:

Lineage for d3du2m_ (3du2 M:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d3du2m_: 3du2 M: [245670]
   Other proteins in same PDB: d3du2h1, d3du2h2, d3du2l_
   automated match to d2j8dm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d3du2m_

PDB Entry: 3du2, 3.1 Å

PDB Description: e(l212)a mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3du2m_:

Sequence; same for both SEQRES and ATOM records:

>d3du2m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d3du2m_:

• d3du2m_ is new in SCOPe 2.04-stable
  
• d3du2m_ appears in SCOPe 2.05
  
• d3du2m_ appears in the current release, SCOPe 2.08