Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries) Uniprot P02953 |
Domain d3du2m_: 3du2 M: [245670] Other proteins in same PDB: d3du2h1, d3du2h2, d3du2l_ automated match to d2j8dm_ complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant |
PDB Entry: 3du2 (more details), 3.1 Å
SCOPe Domain Sequences for d3du2m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3du2m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d3du2m_: