![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
![]() | Protein automated matches [254629] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255600] (2 PDB entries) |
![]() | Domain d3do7a1: 3do7 A:88-278 [245649] Other proteins in same PDB: d3do7a2, d3do7b2 automated match to d1ikna2 protein/DNA complex |
PDB Entry: 3do7 (more details), 3.05 Å
SCOPe Domain Sequences for d3do7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3do7a1 b.2.5.3 (A:88-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sctlgrlvspgpcprpylviteqpkqrgmrfryecegrsagsilgessteasktqpaiel rdcgglrevevtaclvwkdwphrvhphslvgkdctdgvcrvrlrphvsprhsfnnlgiqc vrkkeieaaierkiqlgidpynagslknhqevdmnvvricfqasyrdqqghlhrmdpils epvydkkstnt
Timeline for d3do7a1: