PDB entry 3do7

View 3do7 on RCSB PDB site
Description: X-ray structure of a NF-kB p52/RelB/DNA complex
Class: transcription/DNA
Keywords: PROTEIN-DNA COMPLEX, Nucleus, Activator, Alternative splicing, ANK repeat, Chromosomal rearrangement, Cytoplasm, Disease mutation, DNA-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Transcription, Transcription regulation, Ubl conjugation, TRANSCRIPTION/DNA COMPLEX
Deposited on 2008-07-03, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.23
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avian reticuloendotheliosis viral (V-rel) oncogene related B
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VE46 (0-295)
      • conflict (54)
    Domains in SCOPe 2.07: d3do7a1, d3do7a2
  • Chain 'B':
    Compound: Nuclear factor NF-kappa-B p100 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: NFKB2, LYT10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00653 (0-292)
      • conflict (163)
    Domains in SCOPe 2.07: d3do7b1, d3do7b2
  • Chain 'C':
    Compound: 5'-d(*dcp*dgp*dgp*dgp*dap*dap*dtp*dtp*dcp*dcp*dc)-3'
  • Chain 'D':
    Compound: 5'-d(*dcp*dgp*dgp*dgp*dap*dap*dtp*dtp*dcp*dcp*dc)-3'
  • Chain 'E':
    Compound: 5'-d(*dcp*dgp*dgp*dgp*dap*dap*dtp*dtp*dcp*dcp*dc)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3do7A (A:)
    sctlgrlvspgpcprpylviteqpkqrgmrfryecegrsagsilgessteasktqpaiel
    rdcgglrevevtaclvwkdwphrvhphslvgkdctdgvcrvrlrphvsprhsfnnlgiqc
    vrkkeieaaierkiqlgidpynagslknhqevdmnvvricfqasyrdqqghlhrmdpils
    epvydkkstntselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfs
    qadvhrqiaivfktppyedleisepvtvnvflqrltdgvcseplpftylprdhdsy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3do7B (B:)
    gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
    thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
    qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrdsdgsfslplkpvisqp
    ihdskspgasnlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdf
    sptdvhkqyaivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyplv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.