SCOPe 2.04: Domain d3do7a1: 3do7 A:88-278

Lineage for d3do7a1 (3do7 A:88-278)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein automated matches [254629] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255600] (2 PDB entries)

8. Domain d3do7a1: 3do7 A:88-278 [245649]
   Other proteins in same PDB: d3do7a2, d3do7b2
   automated match to d1ikna2
   protein/DNA complex

Details for d3do7a1

PDB Entry: 3do7, 3.05 Å

PDB Description: X-ray structure of a NF-kB p52/RelB/DNA complex

PDB Compounds: (A:) Avian reticuloendotheliosis viral (V-rel) oncogene related B

SCOPe Domain Sequences for d3do7a1:

Sequence; same for both SEQRES and ATOM records:

>d3do7a1 b.2.5.3 (A:88-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sctlgrlvspgpcprpylviteqpkqrgmrfryecegrsagsilgessteasktqpaiel
rdcgglrevevtaclvwkdwphrvhphslvgkdctdgvcrvrlrphvsprhsfnnlgiqc
vrkkeieaaierkiqlgidpynagslknhqevdmnvvricfqasyrdqqghlhrmdpils
epvydkkstnt

Timeline for d3do7a1:

• d3do7a1 is new in SCOPe 2.04-stable
  
• d3do7a1 appears in SCOPe 2.05
  
• d3do7a1 appears in the current release, SCOPe 2.08