Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [255798] (1 PDB entry) |
Domain d3dezb_: 3dez B: [245633] Other proteins in same PDB: d3deza2 automated match to d4ohca_ complexed with so4 |
PDB Entry: 3dez (more details), 2.4 Å
SCOPe Domain Sequences for d3dezb_:
Sequence, based on SEQRES records: (download)
>d3dezb_ c.61.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]} mtlakdiardlldikavylkpeepftwasgikspiytdnritlsypetrtliengfveti keafpeveviagtatagiphgaiiadkmnlplayirskpkdhgagnqiegrvtkgqkmvi iedlistggsvldavaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyseli kvakvqgyidadgltllkkfkenqetwq
>d3dezb_ c.61.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]} mtlakdiardlldikavylkpeepftkspiytdnritlsypetrtliengfvetikeafp eveviagtatagiphgaiiadkmnlplayirsqiegrvtkgqkmviiedlistggsvlda vaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyselikvakvqgyidadgl tllkkfkenqetwq
Timeline for d3dezb_: