Lineage for d3deza1 (3dez A:1-209)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2128866Species Streptococcus mutans [TaxId:1309] [255798] (1 PDB entry)
  8. 2128867Domain d3deza1: 3dez A:1-209 [245632]
    Other proteins in same PDB: d3deza2
    automated match to d4ohca_
    complexed with so4

Details for d3deza1

PDB Entry: 3dez (more details), 2.4 Å

PDB Description: Crystal structure of Orotate phosphoribosyltransferase from Streptococcus mutans
PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3deza1:

Sequence, based on SEQRES records: (download)

>d3deza1 c.61.1.0 (A:1-209) automated matches {Streptococcus mutans [TaxId: 1309]}
mtlakdiardlldikavylkpeepftwasgikspiytdnritlsypetrtliengfveti
keafpeveviagtatagiphgaiiadkmnlplayirskpkdhgagnqiegrvtkgqkmvi
iedlistggsvldavaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyseli
kvakvqgyidadgltllkkfkenqetwqd

Sequence, based on observed residues (ATOM records): (download)

>d3deza1 c.61.1.0 (A:1-209) automated matches {Streptococcus mutans [TaxId: 1309]}
mtlakdiardlldikavylkpeepftwikspiytdnritlsypetrtliengfvetikea
fpeveviagtatagiphgaiiadkmnlplayirskpknqiegrvtkgqkmviiedlistg
gsvldavaaaqregadvlgvvaiftyelpkatanfekasvklvtlsnyselikvakvqgy
idadgltllkkfkenqetwqd

SCOPe Domain Coordinates for d3deza1:

Click to download the PDB-style file with coordinates for d3deza1.
(The format of our PDB-style files is described here.)

Timeline for d3deza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3deza2
View in 3D
Domains from other chains:
(mouse over for more information)
d3dezb_