SCOPe 2.04: Domain d3dbic_: 3dbi C:

Lineage for d3dbic_ (3dbi C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (49 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225166] (3 PDB entries)

8. Domain d3dbic_: 3dbi C: [245618]
   automated match to d3brqb_
   protein/DNA complex; complexed with gol, po4

Details for d3dbic_

PDB Entry: 3dbi, 2.45 Å

PDB Description: crystal structure of sugar-binding transcriptional regulator (laci family) from escherichia coli complexed with phosphate

PDB Compounds: (C:) Sugar-binding transcriptional regulator, LacI family

SCOPe Domain Sequences for d3dbic_:

Sequence; same for both SEQRES and ATOM records:

>d3dbic_ c.93.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
stqtlglvvtntlyhgiyfsellfhaarmaeekgrqllladgkhsaeeerqaiqylldlr
cdaimiyprflsvdeiddiidahsqpimvlnrrlrknsshsvwcdhkqtsfnavaelina
ghqeiafltgsmdsptsierlagykdalaqhgialnekliangkwtpasgaegvemller
gakfsalvasnddmaigamkalhergvavpeqvsvigfddiaiapytvpalssvkipvte
miqeiigrlifmldggdfsppktfsgklirrdsliap

Timeline for d3dbic_:

• d3dbic_ is new in SCOPe 2.04-stable
  
• d3dbic_ appears in SCOPe 2.05
  
• d3dbic_ appears in the current release, SCOPe 2.08