Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d3czjb3: 3czj B:334-625 [245584] Other proteins in same PDB: d3czja1, d3czja2, d3czja4, d3czja5, d3czjb1, d3czjb2, d3czjb4, d3czjb5, d3czjc1, d3czjc2, d3czjc4, d3czjc5, d3czjd1, d3czjd2, d3czjd4, d3czjd5 automated match to d1jz7a5 complexed with 149, dms, mg, na |
PDB Entry: 3czj (more details), 2.05 Å
SCOPe Domain Sequences for d3czjb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czjb3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgtesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3czjb3:
View in 3D Domains from same chain: (mouse over for more information) d3czjb1, d3czjb2, d3czjb4, d3czjb5 |