![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d3czjb5: 3czj B:731-1023 [245586] Other proteins in same PDB: d3czja1, d3czja2, d3czja3, d3czja4, d3czjb1, d3czjb2, d3czjb3, d3czjb4, d3czjc1, d3czjc2, d3czjc3, d3czjc4, d3czjd1, d3czjd2, d3czjd3, d3czjd4 automated match to d1jz8a4 complexed with 149, dms, mg, na |
PDB Entry: 3czj (more details), 2.05 Å
SCOPe Domain Sequences for d3czjb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czjb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3czjb5:
![]() Domains from same chain: (mouse over for more information) d3czjb1, d3czjb2, d3czjb3, d3czjb4 |