![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily) multihelical; consists of two all-alpha subdomains |
![]() | Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) ![]() automatically mapped to Pfam PF03441 |
![]() | Family a.99.1.0: automated matches [231382] (1 protein) not a true family |
![]() | Protein automated matches [231383] (1 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (6 PDB entries) |
![]() | Domain d3cvya2: 3cvy A:216-505 [245569] Other proteins in same PDB: d3cvya1 automated match to d2wb2a2 protein/DNA complex; complexed with fad |
PDB Entry: 3cvy (more details), 2.7 Å
SCOPe Domain Sequences for d3cvya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cvya2 a.99.1.0 (A:216-505) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevr
Timeline for d3cvya2: